PDB entry 1hh2

View 1hh2 on RCSB PDB site
Description: crystal structure of nusa from thermotoga maritima
Class: transcription regulation
Keywords: transcription regulation, termination
Deposited on 2000-12-18, released 2001-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2439
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: n utilization substance protein a
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nusA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hh2p1, d1hh2p2, d1hh2p3, d1hh2p4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh2P (P:)
    mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
    llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
    lekekqfekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkv
    yiidvvkttkgpkilvsrrvpefviglmkleipevengiveikaiarepgvrtkvavasn
    dpnvdpigacigeggsriaailkelkgekldvlkwsddpkqlianalapatvieveildk
    enkaarvlvpptqlslaigkggqnarlaakltgwkidikpimnl