PDB entry 1hh1

View 1hh1 on RCSB PDB site
Description: the structure of hjc, a holliday junction resolving enzyme from sulfolobus solfataricus
Class: holliday junction resolvase
Keywords: holliday junction resolvase, homologous recombination, nuclease domain, archaea
Deposited on 2000-12-18, released 2001-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction resolving enzyme hjc
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1hh1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hh1A (A:)
    mnakkrkgsavernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrk
    diegkiyvrreqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseie
    gldledlvrlveakisrtldnfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hh1A (A:)
    savernivsrlrdkgfavvrapapipdiialkngviiliemksrkdiegkiyvrreqaeg
    iiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveaki
    srtld