PDB entry 1hh0

View 1hh0 on RCSB PDB site
Description: filamentous bacteriophage ph75
Class: virus
Keywords: virus, virus coat protein, helical virus coat protein, ssDNA viruses, inovirus, filamentous bacteriophage, thermophiles, membrane proteins, helical virus
Deposited on 2000-12-17, released 2001-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: FIBER
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ph75 inovirus major coat protein
    Species: BACTERIOPHAGE PH75 [TaxId:144736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hh0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh0A (A:)
    mdfnpsevasqvtnyiqaiaaagvgvlalaiglsaawkyakrflkg