PDB entry 1hgj

View 1hgj on RCSB PDB site
Description: binding of influenza virus hemagglutinin to analogs of its cell-surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
Class: viral protein
Keywords: INFLUENZA VIRUS HEMAGGLUTININ, Viral protein
Deposited on 1991-11-01, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgja_
  • Chain 'B':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgjb_
  • Chain 'C':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgjc_
  • Chain 'D':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgjd_
  • Chain 'E':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgje_
  • Chain 'F':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hgjf_
  • Heterogens: NAG, AMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjE (E:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hgjF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg