PDB entry 1hgg

View 1hgg on RCSB PDB site
Description: binding of influenza virus hemagglutinin to analogs of its cell-surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
Class: Viral protein
Keywords: INFLUENZA VIRUS HEMAGGLUTININ, Viral protein
Deposited on 1991-11-01, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hgga_
  • Chain 'B':
    Compound: hemagglutinin, chain ha2
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hggb_
  • Chain 'C':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hggc_
  • Chain 'D':
    Compound: hemagglutinin, chain ha2
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hggd_
  • Chain 'E':
    Compound: hemagglutinin, chain ha1
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hgge_
  • Chain 'F':
    Compound: hemagglutinin, chain ha2
    Species: Influenza A virus [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hggf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggE (E:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hggF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg