PDB entry 1hg8

View 1hg8 on RCSB PDB site
Description: Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme
Class: hydrolase
Keywords: hydrolase, pectin degradation
Deposited on 2000-12-13, released 2001-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.1728
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endopolygalacturonase
    Species: FUSARIUM MONILIFORME [TaxId:117187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg8a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hg8A (A:)
    dpcsvteysglatavsscknivlngfqvptgkqldlsslqndstvtfkgtttfattadnd
    fnpivisgsnititgasghvidgngqaywdgkgsnsnsnqkpdhfivvqkttgnskitnl
    niqnwpvhcfditgssqltisglildnragdkpnaksgslpaahntdgfdisssdhvtld
    nnhvynqddcvavtsgtnivvsnmycsgghglsigsvggksdnvvdgvqflssqvvnsqn
    gcriksnsgatgtinnvtyqnialtnistygvdvqqdylnggptgkptngvkisnikfik
    vtgtvassaqdwfilcgdgscsgftfsgnaitgggktsscnyptntcps