PDB entry 1hg4

View 1hg4 on RCSB PDB site
Description: Ultraspiracle ligand binding domain from Drosophila melanogaster
Class: nuclear hormone receptor
Keywords: nuclear hormone receptor, transcription factor, ligand binding
Deposited on 2000-12-12, released 2001-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4a_
  • Chain 'B':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4b_
  • Chain 'C':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4c_
  • Chain 'D':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4d_
  • Chain 'E':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4e_
  • Chain 'F':
    Compound: ultraspiracle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hg4f_
  • Heterogens: LPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hg4A (A:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4A (A:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqpqqlflnqsfsyhrnsaikagv
    saifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyaclde
    hcrlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hg4B (B:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4B (B:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqpqqlflnqsfsyhrnsaikagv
    saifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyaclde
    hcrlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hg4C (C:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4C (C:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqqlflnqsfsyhrnsaikagvsa
    ifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyacldehc
    rlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hg4D (D:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4D (D:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqqlflnqsfsyhrnsaikagvsa
    ifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyacldehc
    rlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hg4E (E:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4E (E:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqpqqlflnqsfsyhrnsaikagv
    saifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyaclde
    hcrlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hg4F (F:)
    mtnsvsrdfsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkql
    fqmveyarmmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghd
    gsferrspglqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsc
    lkaiilynpdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsis
    lkcqdhlflfritsdrpleelfleqleappppglamkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg4F (F:)
    fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
    mmphfaqvplddqvillkaawiellianvawcsivslqpqqlflnqsfsyhrnsaikagv
    saifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyaclde
    hcrlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg