PDB entry 1hg3

View 1hg3 on RCSB PDB site
Description: crystal structure of tetrameric tim from pyrococcus woesei.
Class: isomerase
Keywords: thermostability, pyrococcus, triosephosphate isomerase, tetrameric
Deposited on 2000-12-12, released 2001-03-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.254
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3b_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3c_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3d_
  • Chain 'E':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3e_
  • Chain 'F':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3f_
  • Chain 'G':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3g_
  • Chain 'H':
    Compound: triosephosphate isomerase
    Species: Pyrococcus woesei
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62003 (Start-224)
      • see remark 999 (210-213)
      • see remark 999 (215-224)
    Domains in SCOP 1.75: d1hg3h_
  • Heterogens: 3PP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hg3A (A:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3A (A:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hg3B (B:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3B (B:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hg3C (C:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3C (C:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hg3D (D:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3D (D:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hg3E (E:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3E (E:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hg3F (F:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3F (F:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hg3G (G:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3G (G:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hg3H (H:)
    maklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesvei
    pvfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmt
    mvcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvl
    cgagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hg3H (H:)
    aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
    vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
    vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
    gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi