PDB entry 1hfx

View 1hfx on RCSB PDB site
Description: alpha-lactalbumin
Class: glycoprotein
Keywords: lactose synthase component, calcium binding metalloprotein, lactose, glycoprotein
Deposited on 1996-06-13, released 1997-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-lactalbumin
  Species: Cavia porcellus [TaxId:10141]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00713 (0-122)
  Domains in SCOPe 2.04: d1hfxa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hfxA (A:)
  kqltkcalshelndlagyrditlpewlciifhisgydtqaivknsdhkeyglfqindkdf
  cessttvqsrnicdiscdklldddltddimcvkkildikgidywlahkplcsdkleqwyc
  eaq