PDB entry 1hfx

View 1hfx on RCSB PDB site
Description: alpha-lactalbumin
Deposited on 1996-06-13, released 1997-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hfx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hfx_ (-)
    kqltkcalshelndlagyrditlpewlciifhisgydtqaivknsdhkeyglfqindkdf
    cessttvqsrnicdiscdklldddltddimcvkkildikgidywlahkplcsdkleqwyc
    eaq