PDB entry 1hfu

View 1hfu on RCSB PDB site
Description: TYPE-2 CU-DEPLETED LACCASE FROM COPRINUS CINEREUS at 1.68 A resolution
Class: oxidoreductase
Keywords: oxidoreductase, laccase, blue multi-copper oxidase, type-2 copper depleted, glycoprotein
Deposited on 2000-12-08, released 2001-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase 1
    Species: COPRINUS CINEREUS [TaxId:5346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y780 (0-502)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1hfua1, d1hfua2, d1hfua3, d1hfua4
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hfuA (A:)
    aivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
    tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
    rgpmviyddndphaalydeddentiitladwyhipapsiqgaaqpdatlingkgryvggp
    aaelsivnveqgkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftg
    qrysfvldanqpvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnp
    aqlneadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqims
    gaqsandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvn
    pvkrdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannpp
    vewaqlceiyddlppeatsiqtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfuA (A:)
    aivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
    tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
    rgpmviyddndphaalydeddentiitladwyhipapsiqqpdatlingkgryvggpaae
    lsivnveqgkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftgqry
    sfvldanqpvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnpaql
    neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
    sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
    rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
    aqlceiyddlppeatsiqtv