PDB entry 1hfq

View 1hfq on RCSB PDB site
Description: comparison of ternary crystal complexes of human dihydrofolate reductase with nadph and a classical antitumor furopyrimdine
Deposited on 1997-11-04, released 1998-01-28
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1hfq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hfq_ (-)
vgslncivavsqnmgigkngdlpwpplrnesryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd