PDB entry 1hfp

View 1hfp on RCSB PDB site
Description: comparison of ternary crystal complexes of human dihydrofolate reductase with nadph and a classical antitumor furopyrimdine
Class: oxidoreductase
Keywords: oxidoreductase, one-carbon metabolism
Deposited on 1997-11-04, released 1998-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-28, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: HOMO SAPIENS
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • engineered (30)
    Domains in SCOP 1.75: d1hfpa_
  • Heterogens: NAP, MOT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hfpA (A:)
    vgslncivavsqnmgigkngdlpwpplrnegryfqrmtttssvegkqnlvimgkktwfsi
    peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
    ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
    vyeknd