PDB entry 1hfg

View 1hfg on RCSB PDB site
Description: nmr solution structure of vmip-II 1-71 from kaposi's sarcoma-associated herpesvirus (minimized average structure).
Class: chemokine
Keywords: chemokine, cxcr4, anatagonist, vmip-II
Deposited on 2000-12-01, released 2001-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Viral macrophage inflammatory protein-II
  Species: HUMAN HERPESVIRUS 8, synthetic [TaxId:37296]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q98157 (0-70)
  Domains in SCOPe 2.08: d1hfga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hfgA (A:)
  lgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
  klmqqlpvtar