PDB entry 1hfb

View 1hfb on RCSB PDB site
Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate
Class: lyase
Keywords: beta-alpha-barrel, lyase
Deposited on 2000-11-30, released 2003-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2079
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfba_
  • Chain 'B':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbb_
  • Chain 'C':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbc_
  • Chain 'D':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbd_
  • Chain 'E':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbe_
  • Chain 'F':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbf_
  • Chain 'G':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbg_
  • Chain 'H':
    Compound: tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hfbh_
  • Heterogens: PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hfbA (A:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbA (A:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgikygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hfbB (B:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbB (B:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hfbC (C:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbC (C:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hfbD (D:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbD (D:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgkaglkygvsitdacigwettedvlrklaaavrqrrevnk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hfbE (E:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbE (E:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hfbF (F:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbF (F:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hfbG (G:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbG (G:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgipaglkygvsitdacigwettedvlrklaaavrqrrevn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hfbH (H:)
    msespmfaangmpkvnqgaeedvrilgydplaspallqvqipatptsletakrgrreaid
    iitgkddrvlvivgpcsihdleaaqeyalrlkklsdelkgdlsiimraylekprttvgwk
    glindpdvnntfninkglqsarqlfvnltniglpigsemldtispqyladlvsfgaigar
    ttesqlhrelasglsfpvgfkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkg
    nehcfvilrggkkgtnydaksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvc
    eqiangenaitgvmiesninegnqgipaegkaglkygvsitdacigwettedvlrklaaa
    vrqrrevnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hfbH (H:)
    vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
    aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
    qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
    gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
    aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
    nqgglkygvsitdacigwettedvlrklaaavrqrrevn