PDB entry 1hf7

View 1hf7 on RCSB PDB site
Description: endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2fluoro-cellobioside at 1.15 a resolution
Class: hydrolase
Keywords: hydrolase, glycosidase, endoglucanase
Deposited on 2000-11-28, released 2001-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-08-09, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.118
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase b
    Species: BACILLUS AGARADHAERENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hf7a_
  • Heterogens: SO4, DCB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hf7A (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    res
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf7A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires