PDB entry 1hf6

View 1hf6 on RCSB PDB site
Description: endoglucanase cel5a from bacillus agaradhaerens in the orthorhombic crystal form in complex with cellotriose
Class: hydrolase
Keywords: hydrolase, cellulose degradation, endoglucanase, glycoshydrolase family 5
Deposited on 2000-11-29, released 2001-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.115
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase b
    Species: BACILLUS AGARADHAERENS [TaxId:76935]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hf6a_
  • Heterogens: CTR, SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hf6A (A:)
    dndsvveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginv
    fraamytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffd
    emselygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsq
    dvhhaadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggv
    fldeaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvreki
    res
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf6A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires