PDB entry 1hf0

View 1hf0 on RCSB PDB site
Description: crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Deposited on 2000-11-27, released 2001-11-10
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-10, with a file datestamp of 2001-11-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2391
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hf0A (A:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksflenqkp
    tseeitmiadqlnmekevirvwfsnrrqkekri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf0A (A:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsn
    rrqkekri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hf0B (B:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksflenqkp
    tseeitmiadqlnmekevirvwfsnrrqkekri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf0B (B:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsn
    rrqkekri