PDB entry 1hf0

View 1hf0 on RCSB PDB site
Description: Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
Class: transcription
Keywords: transcription, oct-1, pou domain, dimer
Deposited on 2000-11-27, released 2001-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2391
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: octamer-binding transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14859
      • engineered mutation (60)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d1hf0a1, d1hf0a2
  • Chain 'B':
    Compound: octamer-binding transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14859
      • engineered mutation (60)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d1hf0b1, d1hf0b2
  • Chain 'M':
    Compound: DNA 5'-d(*cp*ap*cp*ap*tp*tp*tp*gp*ap*ap*ap*gp*gp* cp*ap*ap*ap*tp*gp*gp*ap*g)-3'
  • Chain 'N':
    Compound: DNA 5'-d(*cp*tp*cp*cp*ap*tp*tp*tp*gp*cp*cp*tp*tp* tp*cp*ap*ap*ap*tp*gp*tp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hf0A (A:)
    eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
    sklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksfl
    enqkptseeitmiadqlnmekevirvwfsnrrqkekrin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf0A (A:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsn
    rrqkekri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hf0B (B:)
    eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
    sklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksfl
    enqkptseeitmiadqlnmekevirvwfsnrrqkekrin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hf0B (B:)
    leeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsklkp
    llekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfsn
    rrqkekri
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.