PDB entry 1hex

View 1hex on RCSB PDB site
Description: structure of 3-isopropylmalate dehydrogenase in complex with nad+: ligand-induced loop-closing and mechanism for cofactor specificity
Deposited on 1994-09-09, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1hex__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hex_ (-)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvlrhla