PDB entry 1hev

View 1hev on RCSB PDB site
Description: hevein: the nmr assignment and an assessment of solution-state folding for the agglutinin-toxin motif
Class: lectin
Keywords: lectin
Deposited on 1993-01-14, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hevein
    Species: Hevea brasiliensis [TaxId:3981]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1heva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hevA (A:)
    eqcgrqaggklcpnnlccsqwgwcgstdeycspdhncqsnckd