PDB entry 1hej

View 1hej on RCSB PDB site
Description: c-terminal xylan binding domain from cellulomonas fimi xylanase 11a
Class: hydrolase(xylan degradation)
Keywords: hydrolase(xylan degradation), hydrolase, xylan binding domain, xylanase, beta-sheet
Deposited on 2000-11-22, released 2001-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: endo-1,4-beta-xylanase d
  Species: CELLULOMONAS FIMI [TaxId:1708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54865 (0-87)
  Domains in SCOPe 2.08: d1hejc_

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hejC (C:)
  tgscsvsavrgeewadrfnvtysvsgssswvvtlglnggqsvqsswnaaltgssgtvtar
  pngsgnsfgvtfykngssatpgatcatg