PDB entry 1hef

View 1hef on RCSB PDB site
Description: The crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 1992-09-21, released 1994-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • conflict (35)
    Domains in SCOPe 2.04: d1hefe_
  • Chain 'I':
    Compound: skf 108738 peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1HEF (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hefE (E:)
    pqitlwqrplvtikiggqlkealldtgaddtvleenslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'I':
    No sequence available.