PDB entry 1he8

View 1he8 on RCSB PDB site
Description: ras g12v - pi 3-kinase gamma complex
Class: kinase/hydrolase
Keywords: kinase/hydrolase, complex (phosphoinositide kinase/ras), phosphoinositide 3-kinase gamma - h-ras g12v complex, phosphatidylinositol 3-kinase, pi3k, pi 3-k, pi 3-kinase, second messenger generation, ras effector, h-ras g12v, oncogene protein, gmppnp, GTP, ras-binding domain, heat domain
Deposited on 2000-11-20, released 2001-01-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit, gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (0-End)
      • engineered mutation (79)
    • PDB 1HE8
    Domains in SCOPe 2.01: d1he8a1, d1he8a2, d1he8a3, d1he8a4
  • Chain 'B':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23175 (0-165)
      • engineered mutation (11)
    Domains in SCOPe 2.01: d1he8b_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1he8A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    pladdctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsah
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1he8A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkesl
    wdcdrkfrvkirgidipvlpltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsi
    kikdlpkgallnlqiyckvrllyyvnlllidhrfllrrgeyvlhmwqisnadkltsatnp
    dkensmsisilldnychpisaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
    lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
    lrgcgtamlhdftqqvqviemlqkvtldikslssqvisqlkqklenlqnsqlpesfrvpy
    dpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqi
    lrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstfkdevlnhwlke
    kspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfv
    ltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtdieyirdal
    tvgkneedakkyfldqievcrdkgwtvqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he8B (B:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh