PDB entry 1he8

View 1he8 on RCSB PDB site
Description:
Deposited on 2000-11-20, released 2001-01-08
The last revision prior to the SCOP 1.71 freeze date was dated 2001-01-08, with a file datestamp of 2001-01-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1he8A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    pladdctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsah
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1he8A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkesl
    wdcdrkfrvkirgidipvlpltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsi
    kikdlpkgallnlqiyckvrllyyvnlllidhrfllrrgeyvlhmwqisnadkltsatnp
    dkensmsisilldnychpisaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
    lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
    lrgcgtamlhdftqqvqviemlqkvtldikslssqvisqlkqklenlqnsqlpesfrvpy
    dpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqi
    lrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstfkdevlnhwlke
    kspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfv
    ltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtdieyirdal
    tvgkneedakkyfldqievcrdkgwtvqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he8B (B:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh