PDB entry 1he7

View 1he7 on RCSB PDB site
Description: Human Nerve growth factor receptor TrkA
Class: transferase
Keywords: transferase, trk-receptor, strand-swapping, nerve growth factor
Deposited on 2000-11-20, released 2001-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04629 (0-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1he7a1, d1he7a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1he7A (A:)
    shmpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnpedpipdtnstsgdp
    vekkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1he7A (A:)
    shmpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnped