PDB entry 1he7

View 1he7 on RCSB PDB site
Description: human nerve growth factor receptor trka
Class: transferase
Keywords: transferase, trk-receptor, strand-swapping, nerve growth factor
Deposited on 2000-11-20, released 2001-04-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04629 (0-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.01: d1he7a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1he7A (A:)
shmpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnpedpipdtnstsgdp
vekkde

    Sequence, based on observed residues (ATOM records): (download) 
    >1he7A (A:)
shmpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnpe