PDB entry 1he1

View 1he1 on RCSB PDB site
Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Class: signaling protein
Keywords: signaling protein, signalling complex, exos, rac, pseudomonas aeruginosa, gap, toxin, virulence factor, transition state, protein-protein complex, gtpase, signal transduction
Deposited on 2000-11-18, released 2001-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exoenzyme s
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: EXOS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51451 (0-134)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1he1a1, d1he1a2
  • Chain 'B':
    Compound: exoenzyme s
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: EXOS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51451 (0-134)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1he1b1, d1he1b2
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15154 (0-175)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1he1c1, d1he1c2
  • Chain 'D':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15154 (0-175)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1he1d1, d1he1d2
  • Heterogens: NI, GDP, AF3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1A (A:)
    assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
    iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
    sevallrqavesevs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1B (B:)
    assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
    iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
    sevallrqavesevs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1C (C:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1D (D:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav