PDB entry 1he1

View 1he1 on RCSB PDB site
Description: crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Deposited on 2000-11-18, released 2001-01-02
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-02, with a file datestamp of 2001-01-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1he1a_
  • Chain 'B':
    Domains in SCOP 1.67: d1he1b_
  • Chain 'C':
    Domains in SCOP 1.67: d1he1c_
  • Chain 'D':
    Domains in SCOP 1.67: d1he1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1A (A:)
    assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
    iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
    sevallrqavesevs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1B (B:)
    assavvfkqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalag
    iragsqveesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvm
    sevallrqavesevs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1C (C:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1he1D (D:)
    pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav