PDB entry 1hdz

View 1hdz on RCSB PDB site
Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences
Class: oxidoreductase(nad(a)-choh(d))
Keywords: oxidoreductase(nad(a)-choh(d))
Deposited on 1993-10-15, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00325 (0-373)
      • conflict (46)
    Domains in SCOPe 2.06: d1hdza1, d1hdza2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00325 (0-373)
      • conflict (46)
    Domains in SCOPe 2.06: d1hdzb1, d1hdzb2
  • Heterogens: ZN, CL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdzA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicgtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdzB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicgtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf