PDB entry 1hdy

View 1hdy on RCSB PDB site
Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences
Deposited on 1993-10-15, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdyA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdyB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf