PDB entry 1hdy

View 1hdy on RCSB PDB site
Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences
Class: oxidoreductase(nad(a)-choh(d))
Keywords: oxidoreductase(nad(a)-choh(d))
Deposited on 1993-10-15, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hdya1, d1hdya2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hdyb1, d1hdyb2
  • Heterogens: ZN, NAD, PYZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdyA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdyB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgichtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf