PDB entry 1hdu

View 1hdu on RCSB PDB site
Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with aminocarbonylphenylalanine at 1.75 a
Class: carboxypeptidase
Keywords: carboxypeptidase, cpa, lbhb, inhibitor
Deposited on 2000-11-17, released 2001-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: BOS BOVIS [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1hdua_
  • Chain 'B':
    Compound: carboxypeptidase a
    Species: BOS BOVIS [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1hdub_
  • Chain 'D':
    Compound: carboxypeptidase a
    Species: BOS BOVIS [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1hdud_
  • Chain 'E':
    Compound: carboxypeptidase a
    Species: BOS BOVIS [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.07: d1hdue_
  • Heterogens: ZN, ING, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hduA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hduB (B:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hduD (D:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hduE (E:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn