PDB entry 1hdr

View 1hdr on RCSB PDB site
Description: the crystallographic structure of a human dihydropteridine reductase nadh binary complex expressed in escherichia coli by a cdna constructed from its rat homologue
Deposited on 1993-08-18, released 1994-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.169
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1hdr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hdr_ (-)
earrvlvyggrgalgsrcvqafrarnwwvasvdvveneeasasiivkmtdsfteqadqvt
aevgkllgeekvdailcvaggwaggnakskslfkncdlmwkqsiwtstisshlatkhlke
gglltlagakaaldgtpgmigygmakgavhqlcqslagknsgmppgaaaiavlpvtldtp
mnrksmpeadfsswtpleflvetfhdwitgknrpssgsliqvvttegrteltpayf