PDB entry 1hdq

View 1hdq on RCSB PDB site
Description: crystal structure of bovine pancreatic carboxypeptidase a complexed with d-n-hydroxyaminocarbonyl phenylalanine at 2.3 a
Class: carboxypeptidase
Keywords: carboxypeptidase, cpa, lbhb, inhibitor
Deposited on 2000-11-17, released 2001-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1388
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: BOS BOVIS [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hdqa_
  • Heterogens: INF, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdqA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtlnn