PDB entry 1hdp

View 1hdp on RCSB PDB site
Description: solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1994-03-08, released 1995-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oct-2 pou homeodomain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hdpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdpA (A:)
    rrkkrtsietnvrfaleksflanqkptseeilliaeqlhmekevirvwfcnrrqkekrin
    pcs