PDB entry 1hdp

View 1hdp on RCSB PDB site
Description: solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
Deposited on 1994-03-08, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1hdp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdp_ (-)
    rrkkrtsietnvrfaleksflanqkptseeilliaeqlhmekevirvwfcnrrqkekrin
    pcs