PDB entry 1hdn

View 1hdn on RCSB PDB site
Description: the high-resolution structure of the histidine-containing phosphocarrier protein hpr from escherichia coli determined by restrained molecular dynamics from nmr nuclear overhauser effect data
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-02-10, released 1994-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hdna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdnA (A:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele