PDB entry 1hdn

View 1hdn on RCSB PDB site
Description: the high-resolution structure of the histidine-containing phosphocarrier protein hpr from escherichia coli determined by restrained molecular dynamics from nmr nuclear overhauser effect data
Deposited on 1994-02-10, released 1994-06-22
The last revision prior to the SCOP 1.57 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1hdn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdn_ (-)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele