PDB entry 1hdk

View 1hdk on RCSB PDB site
Description: charcot-leyden crystal protein - pcmbs complex
Deposited on 2000-11-16, released 2001-11-15
The last revision prior to the SCOP 1.69 freeze date was dated 2001-11-15, with a file datestamp of 2001-11-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hdka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hdkA (A:)
    sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hdkA (A:)
    sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsyl