PDB entry 1hdk

View 1hdk on RCSB PDB site
Description: charcot-leyden crystal protein - pcmbs complex
Deposited on 2000-11-16, released 2001-11-15
The last revision prior to the SCOP 1.63 freeze date was dated 2001-11-15, with a file datestamp of 2001-11-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hdka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hdkA (A:)
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsyl