PDB entry 1hdj

View 1hdj on RCSB PDB site
Description: human hsp40 (hdj-1), nmr
Deposited on 1996-05-09, released 1996-11-08
The last revision prior to the SCOP 1.67 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1hdj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hdj_ (-)
mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
reifdrygeeglkgsgc