PDB entry 1hdi

View 1hdi on RCSB PDB site
Description: pig muscle 3-phosphoglycerate kinase complexed with 3-pg and mgadp.
Class: phosphotransferase
Keywords: phosphotransferase, kinase, phosphoglycerate, ternary complex, glycolysis
Deposited on 2000-11-16, released 2001-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HDI (0-412)
    Domains in SCOPe 2.03: d1hdia_
  • Heterogens: AMP, MG, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdiA (A:)
    nkltldklnvkgkrvvmrvdfnvpmaaaqitnnarikaavpsikfclddgaksvvlmshl
    grpdgspmpdkyslqpvaaelksalgkavlflkdcvgpavekacadpaagsvillenlrf
    hveeegkgkdasgnkaagepakikafraslsalgdvyvndafgtahrahssmvgvnlpkk
    agaflmkkelnyfaaaaesperpflailggakvadkiqlinnmldkvnemiigggmaftf
    lkvlnnmeigtslfdeagkkivknlmskaaangvkitlpvdfvtadkfdeqakigqatva
    sgipagwmgldcgpkssakyseavarakqivwngpvgvfeweafaqgtkalmdevvkats
    rgcitiigggdtatccakwntednvshvstgggaslellegkvlpgvdalsnv