PDB entry 1hdg

View 1hdg on RCSB PDB site
Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution
Class: oxidoreductase (aldehy(d)-nad(a))
Keywords: oxidoreductase (aldehy(d)-nad(a))
Deposited on 1995-01-17, released 1995-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TN10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hdgo1, d1hdgo2
  • Chain 'Q':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TN10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hdgq1, d1hdgq2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdgO (O:)
    arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
    tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
    apakgeditvvigcnedqlkpehtiiscascttnsiapivkvlhekfgivsgmlttvhsy
    tndqrvldlphkdlrraraaavniiptttgaakavalvvpevkgkldgmairvptpdgsi
    tdltvlvekettveevnavmkeategrlkgiigyndepivssdiigttfsgifdatitnv
    iggklvkvaswydneygysnrvvdtlelllkm
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdgQ (Q:)
    arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
    tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
    apakgeditvvigcnedqlkpehtiiscascttnsiapivkvlhekfgivsgmlttvhsy
    tndqrvldlphkdlrraraaavniiptttgaakavalvvpevkgkldgmairvptpdgsi
    tdltvlvekettveevnavmkeategrlkgiigyndepivssdiigttfsgifdatitnv
    iggklvkvaswydneygysnrvvdtlelllkm