PDB entry 1hdd

View 1hdd on RCSB PDB site
Description: crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
Deposited on 1991-09-16, released 1992-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1992-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Domains in SCOP 1.57: d1hddc_
• Chain 'D':
  Domains in SCOP 1.57: d1hddd_

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hddC (C:)
  rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hddD (D:)
  rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks