PDB entry 1hda

View 1hda on RCSB PDB site
Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-05-06, released 1994-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy) (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hdaa_
  • Chain 'B':
    Compound: hemoglobin (deoxy) (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hdab_
  • Chain 'C':
    Compound: hemoglobin (deoxy) (alpha chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hdac_
  • Chain 'D':
    Compound: hemoglobin (deoxy) (beta chain)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hdad_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdaA (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdaB (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdaC (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdaD (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh