PDB entry 1hd7

View 1hd7 on RCSB PDB site
Description: a second divalent metal ion in the active site of a new crystal form of human apurinic/apyridinimic endonuclease, ape1, and its implications for the catalytic mechanism
Deposited on 2000-11-09, released 2001-02-16
The last revision prior to the SCOP 1.69 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hd7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hd7A (A:)
    mpkrgkkgavaedgdelrtepeakksktaakkndkeaagegpalyedppdqktspsgkpa
    tlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenklpaelqelpglshqyws
    apsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrglv
    rleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqgf
    gellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdski
    rskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hd7A (A:)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsegl
    shqywsapysgvgllsrqcplkvsygigdeehdqegrvivaefdsfvlvtayvpnagrgl
    vrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnpkgnkknagftpqerqg
    fgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrldyfllshsllpalcdsk
    irskalgsdhcpitlylal