PDB entry 1hd6

View 1hd6 on RCSB PDB site
Description: pheromone er-22, nmr
Class: pheromone
Keywords: pheromone
Deposited on 2000-11-09, released 2000-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone er-22
  Species: Euplotes raikovi [TaxId:5938]
  Database cross-references and differences (RAF-indexed):
  • PDB 1HD6 (0-36)
  Domains in SCOPe 2.08: d1hd6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hd6A (A:)
  dicdiaiaqcsltlcqdcentpicelavkgscpppws