PDB entry 1hcv

View 1hcv on RCSB PDB site
Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)
Class: immunoglobulin
Keywords: camelids, immunoglobulin
Deposited on 1996-07-13, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.243
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA15406 (1-116)
    Domains in SCOPe 2.07: d1hcva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hcvA (A:)
    dvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcvA (A:)
    vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss