PDB entry 1hct

View 1hct on RCSB PDB site
Description: nmr structure of the human src sh2 domain complex
Class: complex (signal transduction/peptide)
Keywords: human pp60c-src sh2 domain, complex (signal transduction/peptide) complex
Deposited on 1994-09-02, released 1995-09-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-pyeeie-oh
    Database cross-references and differences (RAF-indexed):
    • PDB 1HCT (Start-4)
  • Chain 'B':
    Compound: human src
    Species: Homo sapiens [TaxId:9606]
    Gene: NUCLEOTIDE SEQUENCE A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hctb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hctB (B:)
mdsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnv
khykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp